PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g089940.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 727aa    MW: 79197.1 Da    PI: 7.2199
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g089940.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.5e-095175541954
                         HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  Sopim02g089940.0.1 517 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 554
                         664559******************************88 PP

2BELL121.43.9e-39378449172
                BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         +r e+q++k+kLls+l+eVd+rY++y+eq+q+v++sF+ v+g g+a pYt+lA+ka+SrhFrcLkdai  q+
  Sopim02g089940.0.1 378 DRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDLVMGFGAAVPYTALAQKAMSRHFRCLKDAIGAQL 449
                         589*****************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005747.1E-74316447IPR006563POX domain
PfamPF075263.6E-51321445IPR006563POX domain
PROSITE profilePS5007112.568495558IPR001356Homeobox domain
SMARTSM003892.0E-9498562IPR001356Homeobox domain
CDDcd000864.46E-13498559No hitNo description
SuperFamilySSF466895.13E-17500565IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-28501564IPR009057Homeodomain-like
PfamPF059203.6E-18515554IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 727 aa     Download sequence    Send to blast
MGIATQPITL RPCHKYPVIQ QVVENLNSMS QDYHHHSLFS FPNGFERSQA EQQQHQHQQA  60
QQIRRDKLRV QGFEPFEDET SGLPTVYETA GMLSEMFNFP PGNAATNAAE LLETQFNPNF  120
RQPNPRIHAA AAMGNEWFGN HRQGMVVGGG ASSQPLGYAK NHTDSMQLFL MNPQPRSPSP  180
SPPNSTSSTL HMLLPNPSST PTLQGFPNPA EGSFGQFMTW GNGGASAATA THHLNAQNEI  240
GGVNVVESQG LSLSLSSSLQ HKAEELQMSG EAGGMLFFNQ GGSSTSGQYR YKNMNMGGSG  300
ISPNIHQVHV GYGSSLGVVN VLRNSKYAKA AQELLEEFCS VGRGKLKKNN NKAAANNPSG  360
GANNEASSKD VPTLSAADRI EHQRRKVKLL SMLDEVDRRY NHYCEQMQMV VNSFDLVMGF  420
GAAVPYTALA QKAMSRHFRC LKDAIGAQLK QSCELLGEKD AGTSGLTKGE TPRLKMLEQS  480
LRQQRAFHQM GMMEQEAWRP QRGLPERSVN ILRAWLFEHF LHPYPSDADK HLLARQTGLS  540
RNQVSNWFIN ARVRLWKPMV EDMYQQEAKD EDENSQSQNS GNNIIAQTPT PNSLTNSSST  600
NITTATAAAT TTTAPTTTTA LAAAETGTAA TPITVTSSKR SQINATDSDP SLVAINSFSE  660
NQATFTTNIH DPDACRRGNF SGDDGTTTHD HMGSTMIRFG TTAGDVSLTL GLRHAGNLPE  720
NTHFFG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_B2e-16504561562Homeobox protein Meis2
4xrm_A2e-16504561562Homeobox protein Meis2
3k2a_B2e-16504561562Homeobox protein Meis2
3k2a_A2e-16504561562Homeobox protein Meis2
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU3526540.0EU352654.1 Solanum lycopersicum BIPINNATA (BIP) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004232087.10.0PREDICTED: BEL1-like homeodomain protein 2
SwissprotQ9SW801e-170BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLK4BCE50.0K4BCE5_SOLLC; Uncharacterized protein
STRINGSolyc02g089940.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33412139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-151BEL1-like homeodomain 2